PDB entry 1euh

View 1euh on RCSB PDB site
Description: apo form of a nadp dependent aldehyde dehydrogenase from streptococcus mutans
Class: oxidoreductase
Keywords: dehydrogenase, oxidoreductase
Deposited on 1998-11-05, released 1999-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.221
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadp dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase
    Species: Streptococcus mutans [TaxId:1309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1euha_
  • Chain 'B':
    Compound: nadp dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase
    Species: Streptococcus mutans [TaxId:1309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1euhb_
  • Chain 'C':
    Compound: nadp dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase
    Species: Streptococcus mutans [TaxId:1309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1euhc_
  • Chain 'D':
    Compound: nadp dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase
    Species: Streptococcus mutans [TaxId:1309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1euhd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1euhA (A:)
    mtkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawrals
    yieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmeg
    evleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkppt
    qgsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigk
    magmrpimlelggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadel
    vekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlic
    pilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgi
    aeqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euhA (A:)
    tkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawralsy
    ieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmege
    vleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkpptq
    gsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigkm
    agmrpimlelggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadelv
    ekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlicp
    ilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgia
    eqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1euhB (B:)
    mtkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawrals
    yieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmeg
    evleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkppt
    qgsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigk
    magmrpimlelggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadel
    vekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlic
    pilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgi
    aeqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euhB (B:)
    tkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawralsy
    ieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmege
    vleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkpptq
    gsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigkm
    agmrpimlelggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadelv
    ekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlicp
    ilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgia
    eqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1euhC (C:)
    mtkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawrals
    yieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmeg
    evleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkppt
    qgsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigk
    magmrpimlelggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadel
    vekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlic
    pilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgi
    aeqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euhC (C:)
    tkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawralsy
    ieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmege
    vleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkpptq
    gsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigkm
    agmrpimlelggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadelv
    ekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlicp
    ilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgia
    eqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1euhD (D:)
    mtkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawrals
    yieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmeg
    evleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkppt
    qgsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigk
    magmrpimlelggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadel
    vekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlic
    pilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgi
    aeqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euhD (D:)
    tkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawralsy
    ieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmege
    vleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkpptq
    gsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigkm
    agmrpimlelggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadelv
    ekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlicp
    ilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgia
    eqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik