PDB entry 1eug

View 1eug on RCSB PDB site
Description: crystal structure of escherichia coli uracil DNA glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited
Class: hydrolase
Keywords: glycosylase, hydrolase
Deposited on 1998-10-12, released 1999-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glycosylase)
    Species: Escherichia coli [TaxId:37762]
    Gene: UNG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12295 (Start-228)
      • mutation (212)
    Domains in SCOPe 2.07: d1euga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eugA (A:)
    maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
    lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
    llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
    hvlkaphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eugA (A:)
    ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
    pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
    vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
    aphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese