PDB entry 1euf

View 1euf on RCSB PDB site
Description: bovine duodenase(new serine protease), crystal structure
Class: hydrolase
Keywords: bovine duodenase, serine protease, dual specificity, HYDROLASE
Deposited on 2000-04-14, released 2001-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.179
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: duodenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80219 (0-223)
      • insertion (48)
      • conflict (174)
      • conflict (199)
      • conflict (216)
      • conflict (219-221)
      • conflict (223)
    Domains in SCOPe 2.07: d1eufa_
  • Heterogens: NAG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eufA (A:)
    iiggheakphsrpymafllfktsgkshicggflvredfvltaahclgssinvtlgahnim
    erertqqvipvrrpiphpdyndetlandimllkltrkaditdkvspinlprslaevkpgm
    mcsvagwgrlgvnmpstdklqevdlevqseekciarfknyipftqicagdpskrknsfsg
    dsggplvcngvaqgivsygrndgttpdvytrissflswihstmrryk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eufA (A:)
    iiggheakphsrpymafllfktsgkshicggflvredfvltaahclgssinvtlgahnim
    erertqqvipvrrpiphpdyndetlandimllkltrkaditdkvspinlprslaevkpgm
    mcsvagwgrlgvnmpstdklqevdlevqseekciarfknyipftqicagdpskrknsfsg
    dsggplvcngvaqgivsygrndgttpdvytrissflswihstmr