PDB entry 1eue

View 1eue on RCSB PDB site
Description: rat outer mitochondrial membrane cytochrome b5
Deposited on 2000-04-19, released 2001-04-04
The last revision prior to the SCOP 1.67 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1euea_
  • Chain 'B':
    Domains in SCOP 1.67: d1eueb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eueA (A:)
dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeeilleqagadatesfed
ighspdaremlkqyyigdvhpndlkp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eueB (B:)
dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeeilleqagadatesfed
ighspdaremlkqyyigdvhpndlkp