PDB entry 1eud

View 1eud on RCSB PDB site
Description: crystal structure of phosphorylated pig heart, GTP-specific succinyl-coa synthetase
Class: ligase
Keywords: ligase, GTP-specific, phosphonohistidine
Deposited on 2000-04-14, released 2000-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.156
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinyl-coa synthetase, alpha chain
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAB94003 (Start-310)
      • modified residue (263)
    Domains in SCOPe 2.06: d1euda1, d1euda2
  • Chain 'B':
    Compound: succinyl-coa synthetase, beta chain
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53590 (1-End)
      • cloning artifact (0)
      • engineered (1)
      • modified residue (332)
      • modified residue (343)
    Domains in SCOPe 2.06: d1eudb1, d1eudb2, d1eudb3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eudA (A:)
    mairhcsytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkth
    lglpvfntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrv
    khrllrqgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttq
    vglgqslcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhns
    gpkskpvvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgtt
    iykefekrkml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eudA (A:)
    csytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpv
    fntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrll
    rqgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgq
    slcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpksk
    pvvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykef
    ekrkml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eudB (B:)
    mvnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvf
    ssglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylai
    lmdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgp
    lqnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifam
    ddksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlggg
    vkesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegt
    nvheaqniltnsglpitsavdledaakkavasvtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eudB (B:)
    mvnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvf
    ssglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylai
    lmdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgp
    lqnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifam
    ddksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlggg
    vkesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegt
    nvheaqniltnsglpitsavdledaakkavasvtk