PDB entry 1euc

View 1euc on RCSB PDB site
Description: crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase
Deposited on 2000-04-14, released 2000-07-27
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-27, with a file datestamp of 2000-07-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.158
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eucA (A:)
    csytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpv
    fntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrll
    rqgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgq
    slcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpksk
    pvvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykef
    ekrkml
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eucB (B:)
    mvnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvf
    ssglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylai
    lmdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgp
    lqnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifam
    ddksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlggg
    vkesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegt
    nvheaqniltnsglpitsavdledaakkavasvt