PDB entry 1eu5

View 1eu5 on RCSB PDB site
Description: structure of e. coli dutpase at 1.45 a
Class: hydrolase
Keywords: distorted jelly roll, HYDROLASE
Deposited on 2000-04-13, released 2000-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.14
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06968 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1eu5a1, d1eu5a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eu5A (A:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedfdatdrgeggfghsgrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eu5A (A:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedf