PDB entry 1eu4

View 1eu4 on RCSB PDB site
Description: crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes
Class: immune system
Keywords: beta grasp, OB fold, superantigen fold, IMMUNE SYSTEM
Deposited on 2000-04-13, released 2000-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superantigen spe-h
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eu4a1, d1eu4a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eu4A (A:)
    nsynttnrhnleslykhdsnlieadsiknspdivtshmlkysvkdknlsvffekdwisqe
    fkdkevdiyalsaqevcecpgkryeafggitltnsekkeikvpvnvwdkskqqppmfitv
    nkpkvtaqevdikvrkllikkydiynnreqkyskgtvtldlnsgkdivfdlyyfgngdfn
    smlkiysnneridstqfhvdvsis