PDB entry 1eu3

View 1eu3 on RCSB PDB site
Description: crystal structure of the superantigen smez-2 (zinc bound) from streptococcus pyogenes
Class: immune system
Keywords: beta grasp, OB fold, superantigen fold, IMMUNE SYSTEM
Deposited on 2000-04-13, released 2000-04-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.207
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superantigen smez-2
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RQQ5 (1-209)
      • cloning artifact (2)
    Domains in SCOPe 2.03: d1eu3a1, d1eu3a2
  • Chain 'B':
    Compound: superantigen smez-2
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RQQ5 (Start-209)
      • cloning artifact (2)
    Domains in SCOPe 2.03: d1eu3b1, d1eu3b2
  • Heterogens: PO4, ZN, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eu3A (A:)
    glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
    fktgdkiavfsvpfdwnylskgkvtaytyggitpyqktsipknipvnlwingkqisvpyn
    eistnkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtndnsdkysfdlfyvgy
    rdkesifkvykdnksfnidkighldieids
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eu3B (B:)
    glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
    fktgdkiavfsvpfdwnylskgkvtaytyggitpyqktsipknipvnlwingkqisvpyn
    eistnkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtndnsdkysfdlfyvgy
    rdkesifkvykdnksfnidkighldieids
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eu3B (B:)
    evdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaandfk
    tgdkiavfsvpfdwnylskgkvtaytyggitpyqktsipknipvnlwingkqisvpynei
    stnkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtndnsdkysfdlfyvgyrd
    kesifkvykdnksfnidkighldieids