PDB entry 1etz

View 1etz on RCSB PDB site
Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins
Class: immune system
Keywords: Anti-sweetener Fab, Antigen-antibody, Complex, Crystal Structure, Receptor Mimicry, Antigen Recognition, IMMUNE SYSTEM
Deposited on 2000-04-13, released 2000-10-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.198
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab nc10.14 - light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ETZ (0-214)
    Domains in SCOPe 2.03: d1etza1, d1etza2
  • Chain 'B':
    Compound: fab nc10.14 - heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ETZ (0-227)
    Domains in SCOPe 2.03: d1etzb1, d1etzb2
  • Chain 'H':
    Compound: fab nc10.14 - heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ETZ (0-227)
    Domains in SCOPe 2.03: d1etzh1, d1etzh2
  • Chain 'L':
    Compound: fab nc10.14 - light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ETZ (0-214)
    Domains in SCOPe 2.03: d1etzl1, d1etzl2
  • Heterogens: GAS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etzA (A:)
    favvtqesalttspgetvtltcrsstgavttsnyaiwvqekpdhlfsgliggtnnrvpgv
    parfsgsligdkaaltvtgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    ftpsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsraecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etzB (B:)
    qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky
    ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt
    tltvssakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfp
    allqsglytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etzH (H:)
    qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky
    ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt
    tltvssakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfp
    allqsglytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etzL (L:)
    favvtqesalttspgetvtltcrsstgavttsnyaiwvqekpdhlfsgliggtnnrvpgv
    parfsgsligdkaaltvtgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    ftpsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsraecs