PDB entry 1etz

View 1etz on RCSB PDB site
Description:
Deposited on 2000-04-13, released 2000-10-18
The last revision prior to the SCOP 1.67 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.198
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1etza1, d1etza2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1etzb1, d1etzb2
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1etzh1, d1etzh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1etzl1, d1etzl2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etzA (A:)
    favvtqesalttspgetvtltcrsstgavttsnyaiwvqekpdhlfsgliggtnnrvpgv
    parfsgsligdkaaltvtgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    ftpsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsraecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etzB (B:)
    qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky
    ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt
    tltvssakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfp
    allqsglytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etzH (H:)
    qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky
    ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt
    tltvssakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfp
    allqsglytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etzL (L:)
    favvtqesalttspgetvtltcrsstgavttsnyaiwvqekpdhlfsgliggtnnrvpgv
    parfsgsligdkaaltvtgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    ftpsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsraecs