PDB entry 1etx

View 1etx on RCSB PDB site
Description: the crystal structure of e. coli fis mutant q74a
Class: transcription activator
Keywords: transcriptional activation region, DNA-binding protein, transcription activator
Deposited on 2000-04-13, released 2000-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.223
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: factor for inversion stimulation
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6R3 (Start-97)
      • mutation (73)
    Domains in SCOPe 2.07: d1etxa_
  • Chain 'B':
    Compound: factor for inversion stimulation
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6R3 (Start-97)
      • mutation (73)
    Domains in SCOPe 2.07: d1etxb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1etxA (A:)
    mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
    plldmvmqytrgnatraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1etxA (A:)
    vltvkplrdsvkqalknyfaqlvndlyelvlaeveqplldmvmqytrgnatraalmmgin
    rgtlrkklkkygmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1etxB (B:)
    mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
    plldmvmqytrgnatraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1etxB (B:)
    rvnsdvltvkplrdsvkqalknyfaqdvndlyelvlaeveqplldmvmqytrgnatraal
    mmginrgtlrkklkkygmn