PDB entry 1etu

View 1etu on RCSB PDB site
Description: structural details of the binding of guanosine diphosphate to elongation factor tu from e. coli as studied by x-ray crystallography
Deposited on 1988-01-15, released 1988-07-16
The last revision prior to the SCOP 1.55 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1etu__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1etu_ (-)
    fertkphvnvgtighvdhgkttltaaittvlaktyggaaxxxxxxxxxxxxxxxgitint
    shveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrq
    vgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaew
    eakilelagfldsyip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1etu_ (-)
    fertkphvnvgtighvdhgkttltaaittvlaktygitintshveydtptrhyahvdcpg
    hadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvdde
    ellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyip