PDB entry 1ett

View 1ett on RCSB PDB site
Description: refined 2.3 angstroms x-ray crystal structure of bovine thrombin complexes formed with the benzamidine and arginine-based thrombin inhibitors napap, 4-tapap and mqpa: a starting point for improving antithrombotics
Class: hydrolase(serine proteinase)
Keywords: hydrolase(serine proteinase)
Deposited on 1992-07-06, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.167
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: epsilon-thrombin
    Domains in SCOP 1.73: d1ett.1
  • Chain 'L':
    Compound: epsilon-thrombin
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ett.1
  • Heterogens: TOS, APH, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ettH (H:)
ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
thvfrlkkwiqkvidrlgs

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >1ettL (L:)
tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr

    Sequence, based on observed residues (ATOM records): (download) 
    >1ettL (L:)
tfgageadcglrplfekkqvqdqtekelfesyiegr