PDB entry 1etr

View 1etr on RCSB PDB site
Description: refined 2.3 angstroms x-ray crystal structure of bovine thrombin complexes formed with the benzamidine and arginine-based thrombin inhibitors napap, 4-tapap and mqpa: a starting point for improving antithrombotics
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: serine proteinase, hydrolase-hydrolase inhibitor complex
Deposited on 1992-07-06, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: epsilon-thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1etr.1
  • Chain 'L':
    Compound: epsilon-thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1etr.1
  • Heterogens: MIT, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etrH (H:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
    itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidrlgs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1etrL (L:)
    tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1etrL (L:)
    tfgageadcglrplfekkqvqdqtekelfesyiegr