PDB entry 1eth

View 1eth on RCSB PDB site
Description: triacylglycerol lipase/colipase complex
Deposited on 1995-09-13, released 1996-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ethA (A:)
    sevcfprlgcfsddapwagivqrplkilpwspkdvdtrfllytnqnqnnyqelvadpsti
    tnsnfrmdrktrfiihgfidkgeedwlsnicknlfkvesvncicvdwkggsrtgytqasq
    nirivgaevayfvevlksslgyspsnvhvighslgshaageagrrtngtieritgldpae
    pcfqgtpelvrldpsdakfvdvihtdaapiipnlgfgmsqtvghldffpnggkqmpgcqk
    nilsqivdidgiwegtrdfvacnhlrsykyyadsilnpdgfagfpcdsynvftankcfpc
    psegcpqmghyadrfpgktngvsqvfylntgdasnfarwrykvsvtlsgkkvtghilvsl
    fgnegnsrqyeiykgtlqpdnthsdefdsdvevgdlqkvkfiwynvinptlprvgaskit
    verndgkvydfcsqetvreevlltlnpc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ethB (B:)
    prgiiinldegelclnsaqcksnccqhdtilslsrcalkarensecsaftlygvyykcpc
    ergltcegdkslvgsitntnfgichnv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ethC (C:)
    sevcfprlgcfsddapwagivqrplkilpwspkdvdtrfllytnqnqnnyqelvadpsti
    tnsnfrmdrktrfiihgfidkgeedwlsnicknlfkvesvncicvdwkggsrtgytqasq
    nirivgaevayfvevlksslgyspsnvhvighslgshaageagrrtngtieritgldpae
    pcfqgtpelvrldpsdakfvdvihtdaapiipnlgfgmsqtvghldffpnggkqmpgcqk
    nilsqivdidgiwegtrdfvacnhlrsykyyadsilnpdgfagfpcdsynvftankcfpc
    psegcpqmghyadrfpgktngvsqvfylntgdasnfarwrykvsvtlsgkkvtghilvsl
    fgnegnsrqyeiykgtlqpdnthsdefdsdvevgdlqkvkfiwynvinptlprvgaskit
    verndgkvydfcsqetvreevlltlnpc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ethD (D:)
    prgiiinldegelclnsaqcksnccqhdtilslsrcalkarensecsaftlygvyykcpc
    ergltcegdkslvgsitntnfgichnv