PDB entry 1eth

View 1eth on RCSB PDB site
Description: triacylglycerol lipase/colipase complex
Class: complex (hydrolase/cofactor)
Keywords: COMPLEX (HYDROLASE-COFACTOR), LIPID DEGRADATION, COMPLEX (HYDROLASE-COFACTOR) complex
Deposited on 1995-09-13, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triacylglycerol acyl-hydrolase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1etha1, d1etha2
  • Chain 'B':
    Compound: colipase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ethb1, d1ethb2
  • Chain 'C':
    Compound: triacylglycerol acyl-hydrolase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ethc1, d1ethc2
  • Chain 'D':
    Compound: colipase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ethd1, d1ethd2
  • Heterogens: CA, C8E, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ethA (A:)
    sevcfprlgcfsddapwagivqrplkilpwspkdvdtrfllytnqnqnnyqelvadpsti
    tnsnfrmdrktrfiihgfidkgeedwlsnicknlfkvesvncicvdwkggsrtgytqasq
    nirivgaevayfvevlksslgyspsnvhvighslgshaageagrrtngtieritgldpae
    pcfqgtpelvrldpsdakfvdvihtdaapiipnlgfgmsqtvghldffpnggkqmpgcqk
    nilsqivdidgiwegtrdfvacnhlrsykyyadsilnpdgfagfpcdsynvftankcfpc
    psegcpqmghyadrfpgktngvsqvfylntgdasnfarwrykvsvtlsgkkvtghilvsl
    fgnegnsrqyeiykgtlqpdnthsdefdsdvevgdlqkvkfiwynvinptlprvgaskit
    verndgkvydfcsqetvreevlltlnpc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ethB (B:)
    vpdprgiiinldegelclnsaqcksnccqhdtilslsrcalkarensecsaftlygvyyk
    cpcergltcegdkslvgsitntnfgichnvgrsds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ethB (B:)
    prgiiinldegelclnsaqcksnccqhdtilslsrcalkarensecsaftlygvyykcpc
    ergltcegdkslvgsitntnfgichnv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ethC (C:)
    sevcfprlgcfsddapwagivqrplkilpwspkdvdtrfllytnqnqnnyqelvadpsti
    tnsnfrmdrktrfiihgfidkgeedwlsnicknlfkvesvncicvdwkggsrtgytqasq
    nirivgaevayfvevlksslgyspsnvhvighslgshaageagrrtngtieritgldpae
    pcfqgtpelvrldpsdakfvdvihtdaapiipnlgfgmsqtvghldffpnggkqmpgcqk
    nilsqivdidgiwegtrdfvacnhlrsykyyadsilnpdgfagfpcdsynvftankcfpc
    psegcpqmghyadrfpgktngvsqvfylntgdasnfarwrykvsvtlsgkkvtghilvsl
    fgnegnsrqyeiykgtlqpdnthsdefdsdvevgdlqkvkfiwynvinptlprvgaskit
    verndgkvydfcsqetvreevlltlnpc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ethD (D:)
    vpdprgiiinldegelclnsaqcksnccqhdtilslsrcalkarensecsaftlygvyyk
    cpcergltcegdkslvgsitntnfgichnvgrsds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ethD (D:)
    prgiiinldegelclnsaqcksnccqhdtilslsrcalkarensecsaftlygvyykcpc
    ergltcegdkslvgsitntnfgichnv