PDB entry 1etd

View 1etd on RCSB PDB site
Description: solution structure of the ets domain from murine ets-1: a winged helix-turn-helix dna binding motif
Deposited on 1995-03-22, released 1996-01-29
The last revision was dated 1996-01-29, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: murine ets-1 transcription factor
    Species: MUS MUSCULUS
    Gene: ETS-1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1etdA (A:)
gsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyekls
rglryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkpdad

    Sequence, based on observed residues (ATOM records):
    >1etdA (A:)
iqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglr
yyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkpdad