PDB entry 1etc

View 1etc on RCSB PDB site
Description: solution structure of the ets domain from murine ets-1: a winged helix-turn-helix dna binding motif
Deposited on 1995-03-22, released 1996-01-29
The last revision prior to the SCOP 1.57 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1etc__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1etc_ (-)
  iqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglr
  yyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkpdad