PDB entry 1etb

View 1etb on RCSB PDB site
Description: the x-ray crystal structure refinements of normal human transthyretin and the amyloidogenic val 30-->met variant to 1.7 angstroms resolution
Class: transport(thyroxine)
Keywords: transport(thyroxine)
Deposited on 1993-05-12, released 1995-01-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.163
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • conflict (108)
    Domains in SCOPe 2.03: d1etb1_
  • Chain '2':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • conflict (108)
    Domains in SCOPe 2.03: d1etb2_
  • Heterogens: T44, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1etb1 (1:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiatllspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1etb1 (1:)
    kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiatllspysysttavvtnpk
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1etb2 (2:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiatllspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1etb2 (2:)
    kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiatllspysysttavvtnp