PDB entry 1etb

View 1etb on RCSB PDB site
Description: the x-ray crystal structure refinements of normal human transthyretin and the amyloidogenic val 30-->met variant to 1.7 angstroms resolution
Deposited on 1993-05-12, released 1995-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.163
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.55: d1etb1_
  • Chain '2':
    Domains in SCOP 1.55: d1etb2_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etb1 (1:)
    kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiatllspysysttavvtnpk
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etb2 (2:)
    kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiatllspysysttavvtnp