PDB entry 1eta

View 1eta on RCSB PDB site
Description: the x-ray crystal structure refinements of normal human transthyretin and the amyloidogenic val 30-->met variant to 1.7 angstroms resolution
Class: transport(thyroxine)
Keywords: transport(thyroxine)
Deposited on 1993-05-12, released 1995-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-126)
      • microheterogeneity (29)
    Domains in SCOPe 2.08: d1eta1_
  • Chain '2':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-126)
      • microheterogeneity (29)
    Domains in SCOPe 2.08: d1eta2_
  • Heterogens: T44, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eta1 (1:)
gptgtgeskcplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtnpke

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eta2 (2:)
gptgtgeskcplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtnpke