PDB entry 1esz

View 1esz on RCSB PDB site
Description: structure of the periplasmic ferric siderophore binding protein fhud complexed with coprogen
Class: metal transport
Keywords: FhuD, iron transport, siderophore binding protein, periplasmic ligand binding protein, ABC transport protein, METAL TRANSPORT
Deposited on 2000-04-11, released 2002-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferrichrome-binding periplasmic protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1esza_
  • Heterogens: CPO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eszA (A:)
    aaidpnrivalewlpvelllalgivpygvadtinyrlwvsepplpdsvidvglrtepnle
    lltemkpsfmvwsagygpspemlariapgrgfnfsdgkqplamarksltemadllnlqsa
    aethlaqyedfirsmkprfvkrgarplllttlidprhmlvfgpnslfqeildeygipnaw
    qgetnfwgstavsidrlaaykdvdvlcfdhdnskdmdalmatplwqampfvragrfqrvp
    avwfygatlsamhfvrvldnaiggka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eszA (A:)
    idpnrivalewlpvelllalgivpygvadtinyrlwvsepplpdsvidvglrtepnlell
    temkpsfmvwsagygpspemlariapgrgfnfsdgkqplamarksltemadllnlqsaae
    thlaqyedfirsmkprfvkrgarplllttlidprhmlvfgpnslfqeildeygipnawqg
    etnfwgstavsidrlaaykdvdvlcfdhdnskdmdalmatplwqampfvragrfqrvpav
    wfygatlsamhfvrvldnai