PDB entry 1esx

View 1esx on RCSB PDB site
Description: 1h, 15n and 13c structure of the hiv-1 regulatory protein vpr : comparison with the n-and c-terminal domain structure, (1-51)vpr and (52-96)vpr
Class: Viral protein
Keywords: helix, amphipatic, turn, Viral protein
Deposited on 2000-04-11, released 2001-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vpr protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1esxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1esxA (A:)
meqapedqgpqrepyndwtlelleelkneavrhfpriwlhslgqhiyetygdtwtgveal
irilqqllfihfrigcrhsrigiiqqrrtrngasks