PDB entry 1esu

View 1esu on RCSB PDB site
Description: s235a mutant of tem1 beta-lactamase
Class: hydrolase
Keywords: serine beta-lactamase, hydrolase, antibiotic resistance
Deposited on 2000-04-11, released 2000-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-260)
      • conflict (58)
      • engineered (209)
    Domains in SCOPe 2.08: d1esua_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1esuA (A:)
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadkagagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw