PDB entry 1esr

View 1esr on RCSB PDB site
Description: crystal structure of human monocyte chemotactic protein-2
Deposited on 2000-04-10, released 2000-12-06
The last revision prior to the SCOP 1.69 freeze date was dated 2000-12-06, with a file datestamp of 2000-12-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.244
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1esra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esrA (A:)
    epdsvsipitccfnvinrkipiqrlesytritniqcpkeavifktqrgkevcadpkerwv
    rdsmkhldqifqnlkp