PDB entry 1esr

View 1esr on RCSB PDB site
Description: crystal structure of human monocyte chemotactic protein-2
Class: cytokine
Keywords: cytokine, chemokine, monocyte chemoattractant protein, hiv-1, pyroglutamic acid, x-ray crystallography
Deposited on 2000-04-10, released 2000-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.244
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monocyte chemotactic protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80075 (0-75)
      • engineered (0)
      • engineered (45)
    Domains in SCOPe 2.07: d1esra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esrA (A:)
    epdsvsipitccfnvinrkipiqrlesytritniqcpkeavifktqrgkevcadpkerwv
    rdsmkhldqifqnlkp