PDB entry 1esr

View 1esr on RCSB PDB site
Description: crystal structure of human monocyte chemotactic protein-2
Class: cytokine
Keywords: cytokine, chemokine, monocyte chemoattractant protein, hiv-1, pyroglutamic acid
Deposited on 2000-04-10, released 2000-12-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: monocyte chemotactic protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80075 (0-75)
    • engineered (45)
  Domains in SCOPe 2.08: d1esra_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1esrA (A:)
  epdsvsipitccfnvinrkipiqrlesytritniqcpkeavifktqrgkevcadpkerwv
  rdsmkhldqifqnlkp