PDB entry 1esq

View 1esq on RCSB PDB site
Description: crystal structure of thiazole kinase mutant (c198s) with ATP and thiazole phosphate.
Class: transferase
Keywords: trimer, alpha-beta protein, TRANSFERASE
Deposited on 2000-04-10, released 2000-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxyethylthiazole kinase
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39593 (12-283)
      • engineered (209)
    Domains in SCOPe 2.06: d1esqa1
  • Chain 'B':
    Compound: hydroxyethylthiazole kinase
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39593 (12-End)
      • expression tag (11)
      • engineered (209)
    Domains in SCOPe 2.06: d1esqb1, d1esqb2
  • Chain 'C':
    Compound: hydroxyethylthiazole kinase
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39593 (12-283)
      • expression tag (0-11)
      • engineered (209)
    Domains in SCOPe 2.06: d1esqc1, d1esqc2
  • Heterogens: MG, SO4, ATP, TZP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1esqA (A:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esqA (A:)
    mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
    alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
    rgnaaeiahtvgvtdiirlaqqaaqklntviaitgevdviadtshvytlhnghklltkvt
    gagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkgpgsfqiellnklst
    vteqdvqewatiervtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1esqB (B:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esqB (B:)
    smdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakia
    galvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaa
    irgnaaeiahtvgvtdiirlaqqaaqklntviaitgevdviadtshvytlhnghklltkv
    tgagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkgpgsfqiellnkls
    tvteqdvqewatiervtv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1esqC (C:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esqC (C:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlgdiirlaqqaaqklntviaitgevdviadts
    hvytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtad
    kgpgsfqiellnklstvteqdvqewatiervtvs