PDB entry 1esq

View 1esq on RCSB PDB site
Description: crystal structure of thiazole kinase mutant (c198s) with atp and thiazole phosphate.
Deposited on 2000-04-10, released 2000-08-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-09, with a file datestamp of 2000-08-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1esqa1
  • Chain 'B':
    Domains in SCOP 1.55: d1esqb1
  • Chain 'C':
    Domains in SCOP 1.55: d1esqc1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1esqA (A:)
    mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
    alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
    rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
    ytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
    pgsfqiellnklstvteqdvqewatiervtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esqA (A:)
    mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
    alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
    rgnaaeiahtvgvtdiirlaqqaaqklntviaitgevdviadtshvytlhnghklltkvt
    gagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkgpgsfqiellnklst
    vteqdvqewatiervtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1esqB (B:)
    smdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakia
    galvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaa
    irgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtsh
    vytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadk
    gpgsfqiellnklstvteqdvqewatiervtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esqB (B:)
    smdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakia
    galvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaa
    irgnaaeiahtvgvtdiirlaqqaaqklntviaitgevdviadtshvytlhnghklltkv
    tgagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkgpgsfqiellnkls
    tvteqdvqewatiervtv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1esqC (C:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esqC (C:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlgdiirlaqqaaqklntviaitgevdviadts
    hvytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtad
    kgpgsfqiellnklstvteqdvqewatiervtvs