PDB entry 1eso

View 1eso on RCSB PDB site
Description: monomeric cu,zn superoxide dismutase from escherichia coli
Class: oxidoreductase
Keywords: oxidoreductase, cu,zn superoxide dismutase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, x-ray crystal structure
Deposited on 1997-06-27, released 1998-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cu, zn superoxide dismutase
  Species: Escherichia coli [TaxId:562]
  Gene: SODC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53635 (0-153)
  Domains in SCOPe 2.07: d1esoa_
• Heterogens: ZN, CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1esoA (A:)
  asekvemnlvtsqgvgqsigsvtitetdkglefspdlkalppgehgfhihakgscqpatk
  dgkasaaesagghldpqntgkhegpegaghlgdlpalvvnndgkatdaviaprlksldei
  kdkalmvhvggdnmsdqpkplggggeryacgvik