PDB entry 1eso

View 1eso on RCSB PDB site
Description: monomeric cu,zn superoxide dismutase from escherichia coli
Deposited on 1997-06-27, released 1998-07-01
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-01, with a file datestamp of 1998-07-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1eso__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eso_ (-)
    asekvemnlvtsqgvgqsigsvtitetdkglefspdlkalppgehgfhihakgscqpatk
    dgkasaaesagghldpqntgkhegpegaghlgdlpalvvnndgkatdaviaprlksldei
    kdkalmvhvggdnmsdqpkplggggeryacgvik