PDB entry 1esn

View 1esn on RCSB PDB site
Description: structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a
Deposited on 2000-04-10, released 2000-11-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-17, with a file datestamp of 2000-11-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1esna_
  • Chain 'B':
    Domains in SCOP 1.55: d1esnb_
  • Chain 'C':
    Domains in SCOP 1.55: d1esnc_
  • Chain 'D':
    Domains in SCOP 1.55: d1esnd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esnA (A:)
    qtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfy
    issnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelit
    tdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipd
    gdktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrfl
    kfregaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksa
    nhaveevrlrk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esnB (B:)
    lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis
    snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittd
    gflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgd
    ktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkf
    regaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanh
    aveevrlrk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esnC (C:)
    lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis
    snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittd
    gflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgd
    ktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkf
    regaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanh
    aveevrlrk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esnD (D:)
    lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis
    snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittd
    gflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgd
    ktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkf
    regaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanh
    aveevrlrk