PDB entry 1esn

View 1esn on RCSB PDB site
Description: structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a
Class: transferase
Keywords: crystal structure, protein-inhibitor complex, transferase
Deposited on 2000-04-10, released 2000-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pantothenate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6I3 (Start-315)
      • modified residue (8)
      • modified residue (28)
      • modified residue (141)
      • modified residue (152)
      • modified residue (207)
      • modified residue (274)
    Domains in SCOPe 2.07: d1esna_
  • Chain 'B':
    Compound: pantothenate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6I3 (Start-315)
      • modified residue (8)
      • modified residue (28)
      • modified residue (141)
      • modified residue (152)
      • modified residue (207)
      • modified residue (274)
    Domains in SCOPe 2.07: d1esnb_
  • Chain 'C':
    Compound: pantothenate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6I3 (Start-315)
      • modified residue (8)
      • modified residue (28)
      • modified residue (141)
      • modified residue (152)
      • modified residue (207)
      • modified residue (274)
    Domains in SCOPe 2.07: d1esnc_
  • Chain 'D':
    Compound: pantothenate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6I3 (Start-315)
      • modified residue (8)
      • modified residue (28)
      • modified residue (141)
      • modified residue (152)
      • modified residue (207)
      • modified residue (274)
    Domains in SCOPe 2.07: d1esnd_
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1esnA (A:)
    msikeqtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsr
    llnfyissnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrr
    velittdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliy
    dvipdgdktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwy
    inrflkfregaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasli
    ltksanhaveevrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esnA (A:)
    qtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfy
    issnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelit
    tdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipd
    gdktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrfl
    kfregaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksa
    nhaveevrlrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1esnB (B:)
    msikeqtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsr
    llnfyissnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrr
    velittdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliy
    dvipdgdktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwy
    inrflkfregaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasli
    ltksanhaveevrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esnB (B:)
    lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis
    snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittd
    gflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgd
    ktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkf
    regaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanh
    aveevrlrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1esnC (C:)
    msikeqtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsr
    llnfyissnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrr
    velittdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliy
    dvipdgdktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwy
    inrflkfregaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasli
    ltksanhaveevrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esnC (C:)
    lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis
    snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittd
    gflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgd
    ktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkf
    regaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanh
    aveevrlrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1esnD (D:)
    msikeqtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsr
    llnfyissnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrr
    velittdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliy
    dvipdgdktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwy
    inrflkfregaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasli
    ltksanhaveevrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esnD (D:)
    lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis
    snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittd
    gflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgd
    ktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkf
    regaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanh
    aveevrlrk