PDB entry 1esm

View 1esm on RCSB PDB site
Description: structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a
Deposited on 2000-04-10, released 2000-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1esma_
  • Chain 'B':
    Domains in SCOP 1.55: d1esmb_
  • Chain 'C':
    Domains in SCOP 1.55: d1esmc_
  • Chain 'D':
    Domains in SCOP 1.55: d1esmd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esmA (A:)
    qtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfy
    issnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelit
    tdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipd
    gdktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrfl
    kfregaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksa
    nhaveevrlrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1esmB (B:)
    lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis
    snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittd
    gflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgd
    ktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkf
    regaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanh
    aveevrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esmB (B:)
    lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis
    snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittd
    gflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgd
    ktvvqpdilileglnvlqsgmdydphhvfvsdfvdfsiyvdapedllqtwyinrflkfre
    gaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanhav
    eevrlrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1esmC (C:)
    qtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfy
    issnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelit
    tdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipd
    gdktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrfl
    kfregaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksa
    nhaveevrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esmC (C:)
    qtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfy
    issnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelit
    tdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipd
    gdktvvqpdilileglnvlqsgmdphhvfvsdfvdfsiyvdapedllqtwyinrflkfre
    gaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanhav
    eevrlrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1esmD (D:)
    lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis
    snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittd
    gflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgd
    ktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkf
    regaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanh
    aveevrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esmD (D:)
    lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis
    snlrrqavleqflgtripyiisiagsvavgksttarvlqallsrwpehrrvelittdgfl
    hpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdktv
    vqpdilileglnvlqsgmdyphhvfvsdfvdfsiyvdapedllqtwyinrflkfregaft
    dpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanhaveevr
    lrk