PDB entry 1esl

View 1esl on RCSB PDB site
Description: insight into e-selectin(slash)ligand interaction from the crystal structure and mutagenesis of the lec(slash)egf domains
Class: cell adhesion protein
Keywords: cell adhesion protein
Deposited on 1994-06-03, released 1994-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.164
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human e-selectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1esla1, d1esla2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eslA (A:)
    wsyntsteamtydeasaycqqrythlvaiqnkeeieylnsilsyspsyywigirkvnnvw
    vwvgtqkplteeaknwapgepnnrqkdedcveiyikrekdvgmwndercskkklalcyta
    actntscsghgecvetinnytckcdpgfsglkceqivnctal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eslA (A:)
    wsyntsteamtydeasaycqqrythlvaiqnkeeieylnsilsyspsyywigirkvnnvw
    vwvgtqkplteeaknwapgepnnrqkdedcveiyikrekdvgmwndercskkklalcyta
    actntscsghgecvetinnytckcdpgfsglkceqiv