PDB entry 1esk

View 1esk on RCSB PDB site
Description: solution structure of ncp7 from hiv-1
Class: Viral protein
Keywords: (12-53)NCp7, HIV-1, PROTEIN, STRUCTURE, NMR, Viral protein
Deposited on 2000-04-10, released 2000-04-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-41)
      • conflict (0)
    Domains in SCOPe 2.01: d1eska_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eskA (A:)
    nvkcfncgkeghtarncraprkkgcwkcgkeghqmkdcterq