PDB entry 1esk

View 1esk on RCSB PDB site
Description: solution structure of ncp7 from hiv-1
Class: Viral protein
Keywords: (12-53)NCp7, HIV-1, PROTEIN, STRUCTURE, NMR, Viral protein
Deposited on 2000-04-10, released 2000-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gag polyprotein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-41)
    • conflict (0)
  Domains in SCOPe 2.08: d1eska_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eskA (A:)
  nvkcfncgkeghtarncraprkkgcwkcgkeghqmkdcterq