PDB entry 1esj

View 1esj on RCSB PDB site
Description: crystal structure of thiazole kinase mutant (c198s)
Deposited on 2000-04-10, released 2000-08-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-09, with a file datestamp of 2000-08-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.229
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1esja1
  • Chain 'B':
    Domains in SCOP 1.55: d1esjb1
  • Chain 'C':
    Domains in SCOP 1.55: d1esjc1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esjA (A:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esjB (B:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esjC (C:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs