PDB entry 1esj

View 1esj on RCSB PDB site
Description: crystal structure of thiazole kinase mutant (c198s)
Class: transferase
Keywords: trimer, alpha-beta protein, TRANSFERASE
Deposited on 2000-04-10, released 2000-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.229
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxyethylthiazole kinase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39593 (12-283)
      • expression tag (0-11)
      • engineered (209)
    Domains in SCOPe 2.07: d1esja1, d1esja2
  • Chain 'B':
    Compound: hydroxyethylthiazole kinase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39593 (12-283)
      • expression tag (0-11)
      • engineered (209)
    Domains in SCOPe 2.07: d1esjb1, d1esjb2
  • Chain 'C':
    Compound: hydroxyethylthiazole kinase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39593 (12-283)
      • expression tag (0-11)
      • engineered (209)
    Domains in SCOPe 2.07: d1esjc1, d1esjc2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esjA (A:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esjB (B:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esjC (C:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs