PDB entry 1esg

View 1esg on RCSB PDB site
Description: restriction endonuclease bamhi bound to a non-specific DNA.
Class: hydrolase/DNA
Keywords: Non-specific DNA-protein complex., HYDROLASE/DNA COMPLEX
Deposited on 2000-04-09, released 2000-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type II restriction enzyme bamhi
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1esga_
  • Chain 'B':
    Compound: type II restriction enzyme bamhi
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1esgb_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*gp*gp*ap*tp*tp*cp*a)-3')
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*ap*ap*tp*cp*cp*a)-3')
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1esgA (A:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgmskrsikkwkdkvenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esgA (A:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgmskrsikkwkdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1esgB (B:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgmskrsikkwkdkvenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esgB (B:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgmskrsikkwkdkven
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.