PDB entry 1esd

View 1esd on RCSB PDB site
Description: the molecular mechanism of enantiorecognition by esterases
Class: hydrolase (serine esterase)
Keywords: hydrolase (serine esterase)
Deposited on 1994-10-07, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: Streptomyces scabiei [TaxId:1930]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1esda_
  • Heterogens: VXA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1esdA (A:)
    apadpvptvffgdsytanfgiapvtnqdsergwcfqakenypavatrsladkgitldvqa
    dvscggalihhfwekqelpfgagelppqqdalkqdtqltvgslggntlgfnrilkqcsde
    lrkpsllpgdpvdgdepaakcgeffgtgdgkqwlddqfervgaeleelldrigyfapdak
    rvlvgyprlvpedttkcltaapgqtqlpfadipqdalpvldqiqkrlndamkkaaadgga
    dfvdlyagtgantacdgadrgigglledsqlellgtkipwyahpndkgrdiqakqvadki
    eeilnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esdA (A:)
    dpvptvffgdsytanfgiapvtnqdsergwcfqakenypavatrsladkgitldvqadvs
    cggalihhfwekqelpfgagelppqqdalkqdtqltvgslggntlgfnrilkqcsdelrk
    psllpgdpvdgdepaakcgeffgtgdgkqwlddqfervgaeleelldrigyfapdakrvl
    vgyprlvpedttkcltaapgqtqlpfadipqdalpvldqiqkrlndamkkaaadggadfv
    dlyagtgantacdgadrgigglledsqlellgtkipwyahpndkgrdiqakqvadkieei
    ln