PDB entry 1esb

View 1esb on RCSB PDB site
Description: direct structure observation of an acyl-enzyme intermediate in the hydrolysis of an ester substrate by elastase
Class: hydrolase
Keywords: hydrolase, serine proteinase
Deposited on 1994-02-04, released 1994-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: porcine pancreatic elastase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • conflict (65)
    Domains in SCOPe 2.08: d1esba_
  • Heterogens: BBL, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esbA (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn