PDB entry 1es9

View 1es9 on RCSB PDB site
Description: x-ray crystal structure of r22k mutant of the mammalian brain platelet-activating factor acetylhydrolases (paf-ah)
Class: hydrolase
Keywords: alpha/beta hydrolase fold
Deposited on 2000-04-07, released 2000-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.192
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: platelet-activating factor acetylhydrolase ib gamma subunit
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29460
      • engineered (21)
    Domains in SCOPe 2.07: d1es9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1es9A (A:)
    msgdenpaskptpvqdvqgdgkwmslhhrfvadskdkepevvfigdslvqlmhqceiwre
    lfsplhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikai
    vqlvnerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvh
    sdgtishhdmydylhlsrlgytpvcralhslllrlltqdqgqggaplpepsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1es9A (A:)
    enpaskptpvqdvqgdgkwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
    lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
    nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
    ishhdmydylhlsrlgytpvcralhslllrll