PDB entry 1es8

View 1es8 on RCSB PDB site
Description: Crystal structure of free BglII
Class: hydrolase
Keywords: RESTRICTION ENDONUCLEASE, RESTRICTION ENZYME, uncomplexed, HYDROLASE
Deposited on 2000-04-07, released 2001-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.214
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: restriction endonuclease bglii
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1es8a_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1es8A (A:)
    mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde
    lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid
    eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi
    vsttyadkrysrtitkrdtvkgkvidtntpntrrrkrgtivty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1es8A (A:)
    mkiditdynhadeilnpqlwkeieetllkmplhvkasslifdpvgtnqyikdelvpkhwk
    nnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhkgmkvaiiitkghm
    fpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidivsttyadkysrtitk
    rdtvkgkvidrgtivty