PDB entry 1es6

View 1es6 on RCSB PDB site
Description: crystal structure of the matrix protein of ebola virus
Class: Viral protein
Keywords: beta sandwich, anti-parallel strands, beta sheet, helix, Viral protein
Deposited on 2000-04-07, released 2000-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.22
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: matrix protein vp40
    Species: Ebola virus sp. [TaxId:205488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q913A4
      • engineered (238)
    Domains in SCOPe 2.07: d1es6a1, d1es6a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1es6A (A:)
    nsntgfltpesvngdtpsnplrpiaddtidhashtpgsvssafileamvnvisgpkvlmk
    qipiwlplgvadqktysfdsttaaimlasytithfgkatnplvrvnrlgpgipdhplrll
    rignqaflqefvlppvqlpqyftfdltalklitqplpaatwtddtptgsngalrpgisfh
    pklrpillpnksgkkgnsadltspekiqaimtslqdfkivpidptknimgievpetlvlk
    ltgkkvtskngqpiipvllpkyigldpvapgdltmvitqdcdtchspaslpaviek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1es6A (A:)
    gdtpsnplrpiaddtidhashtpgsvssafileamvnvisgpkvlmkqipiwlplgvadq
    ktysfdsttaaimlasytithfgkatnplvrvnrlgpgipdhplrllrignqaflqefvl
    ppvqlpqyftfdltalklitqplpaatwtddgalrpgisfhpklrpillpnknsadltsp
    ekiqaimtslqdfkivpidptknimgievpetlvlkltggqpiipvllpkyigldpvapg
    dltmvitqdcdtchspaslp