PDB entry 1es4

View 1es4 on RCSB PDB site
Description: C98N mutant of streptomyces K15 DD-transpeptidase
Class: hydrolase
Keywords: penicillin-binding, dd-transpeptidase, serine peptidase, beta-lactamase, hydrolase carboxypeptidase, hydrolase
Deposited on 2000-04-07, released 2000-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dd-transpeptidase
    Species: Streptomyces sp. [TaxId:1958]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39042 (Start-261)
      • conflict (70-71)
      • engineered (97)
      • conflict (112-113)
      • conflict (155)
    Domains in SCOPe 2.07: d1es4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1es4A (A:)
    vtkptiaavggyamnngtgttlytkaadtrrstgsttkimtakvvlaqsnlnldakvtiq
    kaysdyvvannasqahlivgdkvtvrqllyglmlpsgndaayaladkygsgstraarvks
    figkmntaatnlglhnthfdsfdgignganystprdltkiassamknstfrtvvktkayt
    aktvtktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvl
    astsiparesdatkimnygfal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1es4A (A:)
    kptiaavggyamnngtgttlytkaadtrrstgsttkimtakvvlaqsnlnldakvtiqka
    ysdyvvannasqahlivgdkvtvrqllyglmlpsgndaayaladkygsgstraarvksfi
    gkmntaatnlglhnthfdsfdgianystprdltkiassamknstfrtvvktkaytaktvt
    ktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvlastsi
    paresdatkimnygfal