PDB entry 1es1

View 1es1 on RCSB PDB site
Description: crystal structure of val61his mutant of trypsin-solubilized fragment of cytochrome b5
Deposited on 2000-04-07, released 2000-08-09
The last revision prior to the SCOP 1.69 freeze date was dated 2000-11-15, with a file datestamp of 2000-11-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1es1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1es1A (A:)
  avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedhg
  hstdarelsktfiigelhpddr