PDB entry 1es0

View 1es0 on RCSB PDB site
Description: crystal structure of the murine class II allele I-a(g7) complexed with the glutamic acid decarboxylase (gad65) peptide 207-220
Class: immune system
Keywords: histocompatibility antigen, class II MHC I-a(g7), immune system
Deposited on 2000-04-07, released 2000-06-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class II histocompatibility antigen
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04228 (4-181)
      • see remark 999 (182-183)
    Domains in SCOPe 2.05: d1es0a1, d1es0a2
  • Chain 'B':
    Compound: 65 kd glutamic acid decarboxylase+h-2 class II histocompatibility antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05329
      • see remark 999 (213)
    • GB AAA39547 (Start-212)
    Domains in SCOPe 2.05: d1es0b1, d1es0b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1es0A (A:)
    eddieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfep
    qgglqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppv
    initwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlk
    hwssadlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1es0A (A:)
    dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
    glqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
    itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhw
    ss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1es0B (B:)
    gshsrgyeiapvfvlleyvtgsgsgsgdserhfvhqfkgecyftngtqrirlvtryiynr
    eeylrfdsdvgeyravtelgrhsaeyynkqylertraeldtacrhnyeetevptslrrle
    qpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtf
    qvlvmlemtphqgevytchvehpslkspitvewssadlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1es0B (B:)
    yeiapvfvlleyvtrhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyrav
    telgrhsaeyynkqylertraeldtacrhnyeetevptslrrleqpnvaislsntlvcsv
    tdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtphqgevytchvehps
    lkspitvews