PDB entry 1erz

View 1erz on RCSB PDB site
Description: crystal structure of n-carbamyl-d-amino acid amidohydrolase with a novel catalytic framework common to amidohydrolases
Class: hydrolase
Keywords: four-layer sandwich, HYDROLASE
Deposited on 2000-04-06, released 2001-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-carbamyl-D-amino acid amidohydrolase
    Species: Agrobacterium sp. [TaxId:252128]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1erza_
  • Chain 'B':
    Compound: N-carbamyl-D-amino acid amidohydrolase
    Species: Agrobacterium sp. [TaxId:252128]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1erzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1erzA (A:)
    trqmilavgqqgpiaraetreqvvvrlldmltkaasrganfivfpelalttffprwhftd
    eaeldsfyetempgpvvrplfekaaelgigfnlgyaelvveggvkrrfntsilvdksgki
    vgkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmficndrrwpeaw
    rvmglrgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkvgmee
    ncmllghscivaptgeivaltttledevitaavdldrcrelrehifnfkqhrqpqhygli
    ael
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1erzB (B:)
    trqmilavgqqgpiaraetreqvvvrlldmltkaasrganfivfpelalttffprwhftd
    eaeldsfyetempgpvvrplfekaaelgigfnlgyaelvveggvkrrfntsilvdksgki
    vgkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmficndrrwpeaw
    rvmglrgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkvgmee
    ncmllghscivaptgeivaltttledevitaavdldrcrelrehifnfkqhrqpqhygli
    ael