PDB entry 1ery

View 1ery on RCSB PDB site
Description: pheromone er-11, nmr
Class: pheromone
Keywords: pheromone
Deposited on 1996-03-22, released 1996-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pheromone er-11
  Species: Euplotes raikovi [TaxId:5938]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26887 (0-38)
  Domains in SCOPe 2.08: d1erya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eryA (A:)
  decanaaaqcsitlcnlycgplieiceltvmqnceppfs