PDB entry 1ery

View 1ery on RCSB PDB site
Description: pheromone er-11, nmr
Class: pheromone
Keywords: pheromone
Deposited on 1996-03-22, released 1996-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone er-11
    Species: Euplotes raikovi [TaxId:5938]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1erya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eryA (A:)
    decanaaaqcsitlcnlycgplieiceltvmqnceppfs